PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000128461
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 88aa    MW: 10646.9 Da    PI: 9.7497
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000128461genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM63.37.7e-202172153
            NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka 53
                   + pGfrFhPtdeelv +yLk+kve++ +++ e ik++diyk++PwdLp++vk 
  MDP0000128461 21 MLPGFRFHPTDEELVGFYLKRKVEKRAIRM-ELIKQIDIYKYDPWDLPSQVKF 72
                   579***************************.99***************65443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-181975IPR003441NAC domain
PROSITE profilePS5100520.5692188IPR003441NAC domain
PfamPF023656.7E-92364IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MEVTKAVRNS XEKXEDEEEV MLPGFRFHPT DEELVGFYLK RKVEKRAIRM ELIKQIDIYK  60
YDPWDLPSQV KFRSKLVMRS SKRNIYVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-151275669Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008380332.15e-39PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK551e-26NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLM5WUY31e-30M5WUY3_PRUPE; Uncharacterized protein
STRINGVIT_12s0028g00860.t011e-26(Vitis vinifera)
STRINGPOPTR_0002s05820.12e-26(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114331739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.14e-26NAC domain containing protein 42